Journal of Drug Delivery Science and Technology最新文献

{"title":"Anticancer effects of 6-diazo-5-oxo-L-norleucine (DON)-loaded PLGA nanoparticles in triple-negative breast cancer by inhibiting glutamine metabolism: An integrated bioinformatic and experimental approach","authors":"Cansu Tatar,&nbsp;Aysegul Erdemir","doi":"10.1016/j.jddst.2025.107499","DOIUrl":"10.1016/j.jddst.2025.107499","url":null,"abstract":"<div><div>Triple-negative breast cancer (TNBC) remains a medical problem for which no targeted therapy has been developed because no \"Achilles heel\" feature has been identified. In this study, we sought to elucidate the dependence on glutamine metabolism in TNBC by bioinformatics analysis, identify relevant genes, synthesize 6-diazo-5-oxo-L-norleucine (DON)-loaded PLGA nanoparticles, and evaluate their anticancer effects targeting the glutamine pathway <em>in vitro.</em></div><div>The GEO2R tool was utilized to examine the GSE10843, GSE57083, GSE34211, GSE26370, and GSE263696 datasets and identify differentially expressed genes (DEGs). Pathway enrichment analyses were performed utilizing KEGG, Enrichr, and STRING tools. Gene expression in UALCAN and survival analysis were performed with Kaplan-Meier Plotter. Bioinformatic results revealed that glutamine metabolism is a notable metabolic target in TNBC. DON, the glutamine antagonist selected to inhibit glutamine metabolism, has failed in clinical studies due to systemic toxicity and inadequate specificity. DON-NPs were synthesized to overcome these challenges using the W/O/W double-emulsion solvent evaporation technique. Physicochemical characterization was conducted by ZetaSizer and FT-IR analysis, and cytotoxicity was assessed in MDA-MB-231 cells. The expression of <em>GLS</em>, <em>ASS1</em>, <em>SCD</em>, and <em>RPS6KA2</em> genes detected in bioinformatic analyses was confirmed by qRT-PCR.</div><div>The size of DON-NPs was measured at 176.7 ± 4.53 nm, with a zeta potential of −40.9 ± 2.78 mV and a PDI value of 0.242 ± 0.01. The IC₅₀ values of DON-NPs and DON were determined at 1.9 μg/mL and 4 μg/mL, respectively. DON-NPs exhibited greater anti-proliferative and apoptotic effects than DON, along with reduced <em>GLS</em> expression and enzyme activity.</div><div>Our results demonstrate that DON-NPs for glutamine-dependent TNBC enhanced anticancer effects <em>in vitro</em>.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107499"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145060247","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Initial doxycycline hyclate diffusion and solvent exchange from borneol-based in situ forming matrices using UV–Vis imaging","authors":"Nutdanai Lertsuphotvanit ,&nbsp;Jesper Østergaard ,&nbsp;Pornsit Chaiya ,&nbsp;Warakon Thammasut ,&nbsp;Thawatchai Phaechamud","doi":"10.1016/j.jddst.2025.107521","DOIUrl":"10.1016/j.jddst.2025.107521","url":null,"abstract":"<div><div>UV–Visible (UV–Vis) imaging provides real-time and spatially resolved insights into drug transport, solvent diffusion, and matrix formation, making it a useful tool for evaluating <em>in situ</em> forming matrices (ISMs). ISMs are injectable liquids that solidify upon contact with aqueous environments to sustain drug release. Borneol, a poorly water-soluble and biocompatible monoterpene alcohol, was selected as the matrix former, with triacetin as a hydrophobic co-solvent to modulate drug release in a concentration-dependent manner. This study investigated the effects of borneol matrix and triacetin concentration on solvent exchange, matrix structure, and drug transport in borneol-based ISMs. Formulations containing borneol (40 % w/w), doxycycline hyclate (0.5 % w/w), and triacetin (0–25 % w/w) in <em>N</em>-methyl-2-pyrrolidone (NMP) were characterized by microscopy and UV–Vis imaging to evaluate morphology, solvent diffusion, and drug release. The results showed that borneol matrices effectively restricted solvent and drug transport. Incorporation of 5 % w/w triacetin had a negligible effect on initial solvent exchange and drug release, whereas 25 % w/w triacetin disrupted matrix integrity, resulting in accelerated solvent exchange and unrestricted Dox diffusion. A strong linear correlation between drug and solvent diffusion was observed, with the borneol matrix promoting more efficient drug transport under equivalent solvent diffusion conditions compared to the non-matrix system. Overall, UV–Vis imaging provided real-time insights into solvent exchange mechanisms, matrix formation, and drug release behavior in ISM, confirming that borneol matrices with 5 % w/w triacetin loading can prolong drug release.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107521"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045374","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Phospholipid and triglyceride-based nanocomposites: A versatile approach for colon cancer – bridging basic science to translational applications in drug delivery and beyond","authors":"Neelakanta Sarvashiva Kiran ,&nbsp;Yogitha N. Sagar ,&nbsp;Krishna Badrakiya ,&nbsp;Ankita Chatterjee ,&nbsp;Omar Awad Alsaidan ,&nbsp;Sankha Bhattacharya ,&nbsp;Bhupendra Prajapati","doi":"10.1016/j.jddst.2025.107523","DOIUrl":"10.1016/j.jddst.2025.107523","url":null,"abstract":"<div><div>Phospholipid and triglyceride-based nanocomposites are emerging as pivotal strategies in drug delivery systems, particularly for the treatment of colon cancer. Their inherent biocompatibility and capacity for targeted drug delivery enhance therapeutic efficacy while mitigating systemic toxicity. This review critically evaluates the synthesis, characterization, and mechanistic insights into these nanocomposites, emphasizing their structural properties that facilitate drug encapsulation and release. Additionally, the interactions of these nanocomposites with biological systems are analysed, highlighting their potential for targeted therapy in the challenging landscape of colon cancer treatment. Recent advancements in stimuli-responsive nanocomposite technologies are explored, showcasing their ability to achieve site-specific drug release in response to tumor microenvironments. Furthermore, the review discusses preclinical studies assessing the efficacy and safety of these formulations, with an emphasis on their performance in vitro and in vivo. Emerging trends indicate the versatility of phospholipid and triglyceride-based nanocomposites beyond oncological applications, underscoring their potential in other therapeutic areas. Despite significant progress, challenges related to clinical translation, including regulatory hurdles and optimization of pharmacokinetics, remain. This review underscores the necessity for ongoing research to address these challenges and explore the full therapeutic potential of phospholipid and triglyceride-based nanocomposites, paving the way for innovative treatment strategies in colon cancer and beyond.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107523"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045279","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Antimicrobial peptides-loaded PLGA nanoparticles: Unravelling distinct release profiles and effect against Pseudomonas aeruginosa","authors":"Filipa Campos ,&nbsp;Ana Baião ,&nbsp;Cláudia Monteiro ,&nbsp;M. Cristina L. Martins","doi":"10.1016/j.jddst.2025.107501","DOIUrl":"10.1016/j.jddst.2025.107501","url":null,"abstract":"<div><div>The encapsulation of antimicrobial peptides (AMPs) into nanoparticles (NPs) has been proposed as a strategy to mitigate their rapid degradation <em>in vivo</em>, a key barrier for their clinical translation. However, the efficacy of the AMP-NP systems depends on both the type of NP used and the AMP characteristics. This work aims to explore the encapsulation efficiency (EE), release profile, and antimicrobial performance of three different AMPs - Dhvar5 (LLLFLLKKRKKRKY; 14 aa; +8; 43 % hydrophobic), MSI78 (GIGKFLKKAKKFGKAFVKILKK; 22 aa; +9; 45 % hydrophobic), and LL37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES; 37 aa; +6; 38 % hydrophobic) - loaded into poly (lactic-co-glycolic acid) nanoparticles (PLGA NPs). Their minimal bactericidal concentration (MBC) against <em>Pseudomonas aeruginosa</em>, an opportunistic bacterium commonly involved in clinically persistent infections, was 64 μg/mL (Dhvar5), 1–4 μg/mL (MSI-78) and 32–64 μg/mL (LL37). According to I-TASSER prediction, all the AMPs used adopt an alpha-helical conformation. The EE% increased with AMP size: 50 %, 80 % and 88 % for Dhvar5, MSI78 and LL37, respectively. AMP release after 72h of stirring at 37 °C was higher for MSI78 (60 μg/mL, 46 %), followed by Dhvar5 (44 μg/mL, 60 %). Almost no release was observed for LL37 (8 μg/mL, 6 %). Complete eradication of <em>P. aeruginosa</em> was achieved for both Dhvar5 and MSI78 at 4 μg/mL in phosphate buffer saline (2h). A 2-log reduction was only found for MSI78 (32 μg/mL) in Muller Hinton Broth (2h), with no cytotoxic effects towards HFF-1 human fibroblasts. Overall, these findings suggest that MSI78-NPs was the most promising formulation, combining an efficient release profile with a low MBC.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107501"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045281","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Rice bran extract-assisted synthesis of PMO/ZnO nanocomposites for enhanced gemcitabine loading and anticancer efficacy","authors":"Armin Amirsoleimani ,&nbsp;Zohreh Bahrami ,&nbsp;Khatereh Kafshdouzan","doi":"10.1016/j.jddst.2025.107515","DOIUrl":"10.1016/j.jddst.2025.107515","url":null,"abstract":"<div><div>This study investigates the green synthesis and detailed characterization of PMO/ZnO nanocomposites, using rice bran extract as a sustainable reducing agent to produce ZnO nanoparticles in-situ on periodic mesoporous organosilica (PMO). TEM analysis confirmed the uniform distribution of spherical ZnO nanoparticles, approximately 100 nm in size, within the PMO framework. BET measurements showed a significant decrease in surface area from 1087 m²/g to 498 m²/g after ZnO loading, along with a reduction in pore volume following the encapsulation of gemcitabine. This indicates efficient drug loading, with an efficiency of 49.7 %–54.7 %. Drug release experiments showed pH-responsive behavior, with faster release at acidic conditions (pH 5.6), similar to the tumor microenvironment. MTT cytotoxicity tests on HT-29 colon cancer cells, known for their sensitivity to gemcitabine, displayed enhanced antiproliferative effects with the drug-loaded nanocomposites compared to the free drug. These results underscore the potential of this green-synthesized nanocomposite system as a multifunctional platform, combining biocompatibility, targeted drug delivery, and environmental sustainability, thereby advancing prospects for effective cancer treatments.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107515"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145060245","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Nanoparticle platforms for encapsulation of therapeutic deep eutectic systems to target colorectal cancer cells","authors":"Filipe Oliveira ,&nbsp;Joana Pereira ,&nbsp;Carolina Neca ,&nbsp;Muhamad Hawari Mansor ,&nbsp;Zijian Gao ,&nbsp;Munitta Muthana ,&nbsp;Ana Rita C. Duarte","doi":"10.1016/j.jddst.2025.107517","DOIUrl":"10.1016/j.jddst.2025.107517","url":null,"abstract":"<div><div>Given the growing interest in deep eutectic systems (DES) for their remarkable physicochemical and biological properties, and their alignment with green chemistry principles, we explored their therapeutic potential against colorectal cancer (CRC) in this study. The reported promising selective toxicity of therapeutic deep eutectic systems (THEDES), combining a terpene (menthol, thymol, perillyl alcohol and limonene) with ibuprofen (Ibu), towards CRC cells, have pushed them forward as potential alternative or complementary therapeutics towards CRC. These systems are considered THEDES since they are eutectic systems with a pharmaceutic ingredient as part of its composition. To leverage THEDES viability as CRC therapeutics, different drug delivery systems (DDS), based on poly (lactic-co-glycolic acid) nanoparticles (PLGA-NPs), liposomes (LPS) or niosomes, were explored to ensure THEDES accumulation in cancer sites. For that, nanoprecipitation, microfluidics and thin-film hydration methods were used, respectively, to produce THEDES encapsulated DDS. From the different DDS produced, LPS presented the most promising results regarding size (200 nm), monodispersity, and negative zeta potential averaging −30 mV. These results indicate LPS as a stable, monodispersed particle suspension suitable for cancer-related applications, hence, these NPs were selected for further assessments. The obtained THEDES-LPS revealed expected morphology upon electron microscopy observation (TEM), a 10 % release after 96h, and a maximum encapsulation efficiency (EE%) of 41 % obtained for limonene (Lim):Ibu (4:1). All THEDES-LPS revealed antiproliferative activity towards HT-29 cells which envisage LPS as a DDS for THEDES towards CRC.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107517"},"PeriodicalIF":4.9,"publicationDate":"2025-09-10","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045375","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Preparation of transfersome gel loaded with a composition formed by 6 kinds of active ingredients (TFCom) and evaluation of its multi-dimensional synergistic beauty efficacy based on zebrafish","authors":"Qingping Tian ,&nbsp;Hao Sui ,&nbsp;Liyan Shen ,&nbsp;Ruifen Wang ,&nbsp;Shuhui Kang ,&nbsp;Xiaoya Pang ,&nbsp;Ruixuan Wang ,&nbsp;Yuanyuan Guo ,&nbsp;Yunlan Li ,&nbsp;Guiqing Shen ,&nbsp;Hongxia Yan ,&nbsp;Liwen Han","doi":"10.1016/j.jddst.2025.107504","DOIUrl":"10.1016/j.jddst.2025.107504","url":null,"abstract":"<div><div>To develop a sleep mask with good skin permeability and multi-dimensional skin protection with transfersome gel as carrier. Six water-soluble beauty active ingredients (arbutin, tranexamic acid, hyaluronic acid, allantoin, hydroxyethyl urea and vitamin B12) were selected and mixed in a certain proportion to form a composition (Com6), which can significantly inhibit the ROS level, inflammatory reaction and cell aging of human fibroblasts induced by H₂O₂. The transfersome loaded with Com6 (TF_Com) had a particle size of (94.21 ± 1.36) nm, a PDI of 0.217 ± 0.07, and a Zeta potential of (−46.8 ± 0.26) mV. The steady-state permeation rate and skin retention of vitamin B12 in transfersome were higher than those in liposome, and much higher than those in its solution (<em>P</em> &lt; 0.01). The particles of TF_Com gel (TFG_Com) were uniformly distributed on the gel skeleton, showing a spherical structure, and no mutual aggregation was found. TFG_Com was not irritating to guinea pig skin, had a viscosity of (43.85 ± 0.25) Pa.s that was easy to be wiped evenly and adhere to the skin, and had a pH of (6.82 ± 0.01) suitable for skin use. The TFG_Com demonstrated significant anti-inflammatory effects and effectively reduced melanin levels. It also exhibited a moderate ability to inhibit apoptosis and decrease ROS levels in H₂O₂-induced zebrafish. The six kinds of active components in TFG_Com have no antagonistic effect on these functions, anti-inflammatory and whitening were the results of the synergistic effect of some active substances in Com6. All these indicted that TFG_Com can conveniently protect the skin in a multi-dimensional way, which made it a sleep mask worth developing.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107504"},"PeriodicalIF":4.9,"publicationDate":"2025-09-09","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045372","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Tailoring of magnetic β-cyclodextrin-based nanogels via gamma irradiation: Structural characterization and anticancer efficacy","authors":"Asmaa Sayed ,&nbsp;Amal Shawky ,&nbsp;Ibrahim E. El-Sayed ,&nbsp;Ghada A. Mahmoud","doi":"10.1016/j.jddst.2025.107516","DOIUrl":"10.1016/j.jddst.2025.107516","url":null,"abstract":"<div><div>Targeted drug delivery systems that combine therapeutic efficiency with fewer side effects are highly promoted in cancer treatment. In this study, multifunctional CoFe₂O₄@DEX/PNIPAm nanogels were synthesized through gamma irradiation-induced copolymerization of β-cyclodextrin-modified dextrin (DEX) and N-isopropylacrylamide (NIPAm), followed by the addition of magnetic cobalt ferrite CoFe₂O₄ nanoparticles. The eco-friendly, initiator-free method ensures biocompatibility and environmental safety. Structural (FTIR, XRD) and morphological (TEM, SEM, AFM) analyses confirmed a semi-amorphous nanogel matrix with evenly distributed crystalline nanoparticles, exhibiting increased compactness and altered surface topography at higher irradiation doses. Elemental analysis (EDX and mapping) verified the uniform distribution of Co and Fe within the nanogel. Magnetic measurements indicated soft ferromagnetic behavior where saturation magnetization M_s = 4.16 emu/g and coercivity Hci = 89.5 G, enabling potential magnetic guidance. Functionally, the nanogels demonstrated dose-dependent antibacterial activity against <em>Enterococci</em> and <em>Klebsiella</em>, as well as selective toxicity toward colon cancer cells, with minimal effects on normal fibroblasts (WI-38). These findings suggest CoFe₂O₄@DEX/PNIPAm nanogels as a promising, magnetically responsive, and biocompatible platform for targeted anticancer therapy and antimicrobial applications, offering a green nanomaterial alternative to conventional treatments.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107516"},"PeriodicalIF":4.9,"publicationDate":"2025-09-09","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145060213","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Fish gelatin nanoparticles: An effective carrier for curcumin delivery","authors":"Nida Iqbal ,&nbsp;Amber Bano ,&nbsp;Tehmina Ahmed ,&nbsp;Muhammad Ikram Nabeel ,&nbsp;Junaid Ullah ,&nbsp;Syed Ghulam Musharraf ,&nbsp;Imran Saleem ,&nbsp;Muhammad Imran Malik","doi":"10.1016/j.jddst.2025.107505","DOIUrl":"10.1016/j.jddst.2025.107505","url":null,"abstract":"<div><div>Curcumin is a nutraceutical with numerous medicinal activities due to its anti-inflammatory, antioxidant, antimicrobial, and anti-cancer properties. It has shown promise in treating several diseases, including cancer, diabetes, and cardiovascular diseases. However, the low solubility, instability, and permeability of curcumin render its bioavailability at the target site limited. Thus, new strategies must be explored to exploit the full medicinal potential of curcumin. In this context, drug delivery vehicles may be developed to improve the targeted delivery. Herein, Fish gelatin nanoparticles (FGNPs) were fabricated by the chemical cross-linking method and characterized by numerous techniques, including DLS, AFM, SEM, TGA, FT-IR spectroscopy, UV–visible spectroscopy, fluorescence spectroscopy, and fluorescence microscopy. The loading of curcumin on FGNPs led to a growth in size from 70 nm to 85 nm. The curcumin loading capacity of FGNPs was found to be 75 %, and more than 80 % of the loaded drug was released sustainably in 48 h. The loading and release of curcumin from FGNPs were evaluated using molecular docking and compared with the literature. Different kinetic models were employed to assess the release mechanism of curcumin from Cur-FGNPs. Finally, enhancement in the biological activity by its delivery through Cur-FGNPs was evaluated by its cytotoxicity, anti-cancer, and antioxidant activity. Cytotoxicity assay of FGNPs confirmed that it was fairly safe for healthy cells. The anti-cancer activity of curcumin delivered through Cur-FGNPs has doubled compared to the direct application of curcumin. Similar improvement was also noted in the antioxidant activity of curcumin. Our study demonstrated the excellent potential of FGNPs as a carrier for drugs in general and nutraceuticals in particular to exploit their full potential.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107505"},"PeriodicalIF":4.9,"publicationDate":"2025-09-08","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045369","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Co-delivery of moxifloxacin and prednisolone loaded nanostructured lipid carrier for ocular infections","authors":"Abdulmajeed A. Althobaiti ,&nbsp;Ahmed Adel Ali Youssef ,&nbsp;Ahmed Almotairy ,&nbsp;Mashan Almutairi ,&nbsp;Mohammed Alyahya ,&nbsp;Abeer Abdulghani Alkhodier","doi":"10.1016/j.jddst.2025.107494","DOIUrl":"10.1016/j.jddst.2025.107494","url":null,"abstract":"<div><div>The fixed-dose combination (FDC) strategy involves the combination of a minimum of two active pharmaceutical compounds within a singular unit. Moxifloxacin (MOX) and prednisolone (PRE) are commonly used separately as bactericidal and anti-inflammatory for ocular diseases. In this work, we aim to develop a nanostructured lipid carrier (NLC) formulation of Moxifloxacin (MOX) and prednisolone (PRE) as a combination (MOX-PRE-NLCs) to improve the patient's adherence to the treatment by decreasing the dose frequency, prolonging the therapeutic effect, and preventing the polypharmacy. The MOX and PRE release studies in formulation MOX-PRE-NLCs showed an extended-release of 91.7 ± 1.1 and 63.1 ± 2.3 % over 24 h, respectively. The flux and transcorneal permeability results of MOX and PRE in MOX-PRE-NLCs formulation were (3.66 ± 0.02 μg/min/cm2, 1.49 ± 0.06 μg/min/cm2), and (1.12 ± 0.06 ′ 10-5 cm/s, 2.06 ± 0.09 ′ 10-5 cm/s), respectively. The results showed that formulation MOX-PRE-NLCs significantly improved the corneal flux and permeability of MOX and PRE by 2.8-fold and 3.2-fold compared to the control formulations. The optimized NLCs formulation showed no significant difference (p &gt; 0.05) in PZ, PDI, ZP, DC, EE, and formulation pH at temperatures of 4 °C, 25 °C, and 40 °C over the 90 days of the stability study. Hence, the MOX-PRE-NLCs formulation is a promising delivery system for treating ocular diseases.</div></div>","PeriodicalId":15600,"journal":{"name":"Journal of Drug Delivery Science and Technology","volume":"114 ","pages":"Article 107494"},"PeriodicalIF":4.9,"publicationDate":"2025-09-08","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"145045370","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":3,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}