Xiaosong Yu, Keting Jiang, Yanhui Lv, Changqin Zou, Nantao Xu, Shuyu Wan, Peng Wang, Xingwang Xie, Junjie Jiang, Fangyun Liang, Xi Chen, Jinbo Shen, Huaiyu Zhang, Yi Cai
{"title":"Small peptide from extracellular leucine-rich repeat domain protein 2 modulates cadmium tolerance through regulating photosynthesis and lignin content in rice.","authors":"Xiaosong Yu, Keting Jiang, Yanhui Lv, Changqin Zou, Nantao Xu, Shuyu Wan, Peng Wang, Xingwang Xie, Junjie Jiang, Fangyun Liang, Xi Chen, Jinbo Shen, Huaiyu Zhang, Yi Cai","doi":"10.1016/j.ijbiomac.2026.152413","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152413","url":null,"abstract":"<p><p>With the accelerating global industrialization, cadmium (Cd) pollution in rice has become a significant threat to both ecological safety and human health. Currently, little is known about the small secreted peptides (SSPs) involved in the regulation of the Cd stress response. Here, high-throughput identification of SSPs in Oryza sativa was performed by bioinformatics approaches, and a novel SSP family, small peptide from extracellular leucine-rich repeat (LRR) domain protein (OsSPL), was identified. Hydroponic experiments validated that exogenous application of OsSPL2 alleviated Cd-induced oxidative damage and significantly improved plant phenotypes. Transcriptomic analysis further unveiled potential molecular pathways underlying OsSPL2-mediated Cd stress responses, suggesting its involvement in modulating photosynthetic pathways in leaves and lignin biosynthesis pathways in roots to mitigate Cd stress in rice. Evolutionary analysis indicated that OsSPL family members emerged after plant terrestrialization, underwent gene losses, and predominantly evolved under purifying selection. Additionally, a recombinant protein RPOsSPL2 containing five OsSPL2 repeat units was constructed via a prokaryotic expression system. In vitro assays confirmed its capacity to maintain Cd tolerance in rice, while its stability and scalable production characteristics provided a highly translatable solution for agricultural field applications. The study not only identified a novel signaling molecule of rice responding to Cd stress, but also established the application value of OsSPL2 in the development of environmental adaptive biopesticides through functional validation.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152413"},"PeriodicalIF":8.5,"publicationDate":"2026-05-06","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147855555","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Lin Wang, An Yan, Jing-Hao Suo, Jin-Feng Song, Ze-Fan Jing, Kun-Nian Ran, Bin Yin, Lin Hou, Wei Han, Xiao-Zhong Peng
{"title":"Translational hub ribosomal protein S5 promotes glioblastoma progression by affecting translation patterns.","authors":"Lin Wang, An Yan, Jing-Hao Suo, Jin-Feng Song, Ze-Fan Jing, Kun-Nian Ran, Bin Yin, Lin Hou, Wei Han, Xiao-Zhong Peng","doi":"10.1016/j.ijbiomac.2026.152279","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152279","url":null,"abstract":"<p><p>Ribosomes play pivotal roles in normal physiology, cellular responses to stimuli, and disease pathogenesis. Ribosome biogenesis is essential for cancer cell growth. Although several ribosomal proteins have been implicated in tumorigenesis, their functional roles in glioblastoma multiforme (GBM) remain poorly understood. Using a CRISPR-based screening system targeting RNA-binding proteins (RBPs) in three glioma cell lines (LN229, U118MG, and T98G), we identified essential RBPs for glioma growth and observed significant enrichment of ribosomal proteins. Analysis of TCGA datasets (LGG & GBM, n = 636) revealed that high RPS5 expression was associated with malignant progression; survival analysis via GEPIA (n = 676) showed that elevated RPS5 correlated with poor overall survival (p = 4 × 10<sup>-6</sup>) and disease-free survival (p = 6.9 × 10<sup>-4</sup>). Functional experiments demonstrated that RPS5 silencing inhibited glioma malignant phenotypes both in vitro and in vivo. Mechanistically, RPS5 regulated translational processes in glioma cells, including start/stop codon recognition and cap-independent translation. Ribosome profiling (n = 3) coupled with RNA sequencing revealed that RPS5 enhanced the translational efficiency of SLC4A7 and MAK16, driving GBM progression. Furthermore, bicistronic reporter assays with rigorous controls (promoter-less vector, splicing analysis, and Rluc knockdown) demonstrated that the SLC4A7 5'UTR possesses cap-independent translation activity enhanced by RPS5, whereas RPS5 regulates MAK16 translation without relying on this cap-independent element. Our data reveal a pro-oncogenic role of RPS5 in glioma progression and highlight its critical function in regulating translation. These findings provide new evidence supporting the central role of ribosome protein-induced translational dysregulation in cancer and offer innovative perspectives for developing molecular therapies targeting GBM.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152279"},"PeriodicalIF":8.5,"publicationDate":"2026-05-06","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147855596","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Arul Dhayalan, Sumathi Manoharan, Mohammed Qasim Waheeb, Muhammad Fazle Rabbee, Balasubramani Govindasamy, Silambarasan Tamil Selvan, Perumal Pachiappan
{"title":"An examination of the microbiome of Bacillus cereus (PS5) isolated from Puntius sarana (Olive barb) for α-amylase production, optimization, macromolecule extraction, and structural characterization with industrial and agricultural applications.","authors":"Arul Dhayalan, Sumathi Manoharan, Mohammed Qasim Waheeb, Muhammad Fazle Rabbee, Balasubramani Govindasamy, Silambarasan Tamil Selvan, Perumal Pachiappan","doi":"10.1016/j.ijbiomac.2026.152420","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152420","url":null,"abstract":"<p><p>The α-amylase enzyme plays a vital role in enzyme therapy and the intestinal digestive system, and is widely utilized in the food and pharmaceutical industries. Thus, this study aimed to isolate intestinal bacterial strains that produce α-amylase, optimize enzyme production, and characterize the molecular properties of the produced proteins. A total of 11 strains were isolated from the fish gut; 9 strains were positive for α-amylase production. The PS5 strain exhibited the highest enzymatic activity and was confirmed as Bacillus cereus. Optimization of B. cereus culture conditions revealed parameters of pH 7.0, temperature 35 °C, incubation time 40 h, and starch and yeast extracts of 1.5% and 2.53%, respectively. The bacterial protein was extracted, purified, and shown to have a molecular weight of 55 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. FTIR spectroscopy confirmed the presence of functional groups, such as phenols, alkanes, amides, and aromatic and aliphatic amines. Matrix-assisted laser desorption/ionization (MALDI)-time-of-flight (TOF)-tandem mass spectrometry (MS/MS) analysis identified 12 peptides, with the major peptide sequence being SVGLLLVLLLPMLGAAAPLTTQMLDSGWQFR (m/z 2383.97; S/N 69.3). The α-amylase protein sequence (513 amino acids) was used for structural prediction, while protein-protein interaction analysis revealed a significant interaction with pullulanase (interaction score 0.945). Molecular docking analysis showed strong binding energy of propoxur (-7.2 kcal/mol) and the hormone indole-3-acetic acid (-6.9 kcal/mol) with α-amylase protein. These findings indicate that Bacillus cereus (PS5) is a promising source of α-amylase for diverse industrial and agricultural applications. Further investigation into the activity and stability of these enzymes in natural environments could enhance the associated potential biotechnological applications.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152420"},"PeriodicalIF":8.5,"publicationDate":"2026-05-06","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147855606","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
{"title":"Exploring the effects of Golgi Reassembly and Stacking Proteins in lipid membranes.","authors":"Emanuel Kava, Leonel Malacrida, Marcela Díaz, Rosangela Itri, Antonio J Costa-Filho","doi":"10.1016/j.ijbiomac.2026.152408","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152408","url":null,"abstract":"<p><p>Golgi Reassembly and Stacking Proteins (GRASP) have been associated with Golgi-ribbon structure and unconventional vesicular protein secretion. In performing these functions, GRASPs consistently interact with membranes. The presence of lipid modifications, such as myristoylation, is a crucial consideration for obtaining detailed information about the interactions between GRASPs and membranes. Nonetheless, it has been overlooked in the literature so far. Here, we describe a reconstitution protocol for myristoylated human GRASP65 and GRASP55 in lipid model membranes, enabling investigation of their interactions using techniques ranging from structural characterization to spectroscopy and microscopy. Our results showed that myristoyl-anchored GRASPs can influence lipid packing, membrane dynamics, and hydration, suggesting a possible role for their disordered SPR domains in these interactions.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152408"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831798","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Tania Vanzolini, Valentina Fiori, Tomas Di Mambro, Mauro Magnani
{"title":"Predicting the success of an antibody: Biochemical and biophysical characterization of the humanized monoclonal antibody Dia-T51.","authors":"Tania Vanzolini, Valentina Fiori, Tomas Di Mambro, Mauro Magnani","doi":"10.1016/j.ijbiomac.2026.152185","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152185","url":null,"abstract":"<p><p>Developing effective antibody therapeutics requires not only high affinity, specificity, and potency but also optimal stability and safety. Comprehensive biophysical and biochemical profiling acts as an essential gatekeeper to predict the fate of a candidate and facilitate the transition from bench to bedside. This study evaluates the developability of Dia-T51, an anti-β-1,3-glucan monoclonal antibody humanized from the murine parental 2G8 and designed for antifungal therapy. We employed a multi-technique approach combining UV-Visible, Fluorescence, and Circular Dichroism spectroscopy with in silico molecular modeling to elucidate the mechanisms involved in antigen binding. Our analysis revealed a fundamental divergence between the \"conformational frustration\" and thermodynamic strain exhibited by 2G8 and the cooperative \"induced fit\" mechanism facilitated by the backbone plasticity of Dia-T51. This structural adaptability resulted in superior affinity and thermal stability for the Dia-T51-antigen complex compared to its murine counterpart. Complementary stability assessments demonstrated that Dia-T51 remains free of aggregates and undergoes a structural refinement under physiological stress. Furthermore, samples from a 3-year-old stock of Dia-T51 were subjected to accelerated stability testing to challenge in silico predictions of chemical liabilities within the variable regions. Despite the emergence of minor stress-related structural markers detected by Dynamic Light Scattering and SDS-PAGE, the antibody retained a predominant monomeric profile and high antigen-binding capacity, as confirmed by Surface Plasmon Resonance and ELISA. These findings demonstrate that Dia-T51 possesses the structural resilience and functional robustness required for successful clinical translation, validating its potential for downstream pharmaceutical development and the importance of integrating biophysical data into developability assessments.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152185"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831769","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
{"title":"Milk fat globule membrane from cow, goat, and human differentially modulate Lacticaseibacillus rhamnosus GG: Proteomic insights from human MFGM.","authors":"Soumya Sangam, Utsav Surati, Sudarshan Kumar, Bhavneet Bharti, Manoj Kumar Singh, Rashmi Hogarehalli Mallapa, Diwas Pradhan","doi":"10.1016/j.ijbiomac.2026.152391","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152391","url":null,"abstract":"<p><p>The milk fat globule membrane (MFGM) contains bioactive components with established immune health benefits. However, its role in modulating probiotic functionality and its species specific influence remain incompletely understood. In this study, we compared the effects of bovine, caprine and human MFGM on the probiotic strain Lactobacillus rhamnosus GG (LGG) using a cell line model. Specifically, MFGM treatment was associated with enhanced probiotic functionality, including increased adhesion to intestinal epithelial cells (~3-4 fold), auto-aggregation (~1.85-2.24 fold), cell surface hydrophobicity (~9-27% increase), and co-aggregation with pathogens (~10-27% increase), along with a ~45% reduction in pro-inflammatory TNF-α levels in LPS-stimulated cells. Among the treatments, human MFGM consistently demonstrated the most pronounced effects across major parameters compared to the untreated LGG strain. Label-free proteomic analysis suggested that human MFGM exposure is associated with alterations in bacterial metabolic pathways, including increased abundance of proteins involved in amino acid and pyrimidine biosynthesis, alongside a reduction in proteins linked to energy-intensive processes. These alterations may contribute to enhanced stress tolerance and improved survivability. Furthermore, proteomic profiling identified MFGM-associated proteins that could modulate bacterial surface properties, thereby potentially enhancing adhesion and immunomodulatory activity; however, the observed effects may also involve additional MFGM components. Overall, these findings indicate that the species origin of MFGM is a key determinant of probiotic functionality, with human-derived MFGM exerting the most pronounced effects on LGG. Collectively, the results generate new hypotheses regarding probiotic-MFGM interactions and underscore the potential for leveraging species-specific MFGM in the development of targeted functional foods and early-life nutritional formulations.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152391"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831820","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Sabina Lachowicz-Wiśniewska, Miryam Criado-González, Juan Pedro Fernández Bláquez, Maciej Haranczyk, Rebeca Hernández
{"title":"Pectin-chitosan multilayer films for controlled anthocyanin release: Experimental structure-property relationships supported by complementary principal component analysis (PCA).","authors":"Sabina Lachowicz-Wiśniewska, Miryam Criado-González, Juan Pedro Fernández Bláquez, Maciej Haranczyk, Rebeca Hernández","doi":"10.1016/j.ijbiomac.2026.152335","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152335","url":null,"abstract":"<p><p>Layer-by-layer (LbL) assembly of biological macromolecules has been widely employed to fabricate polymer films for the controlled release of bioactive compounds. Numerous studies have shown that properties such as nano- and microstructure, swelling behavior, and mechanical performance can influence the functionality of these biopolymer films. Because the preparation of LbL films involves many intertwined experimental variables, it becomes challenging to establish a direct correlation between the film architecture and its functional properties. In this work, principal component analysis (PCA) was used as a complementary exploratory tool to integrate mechanical, structural, antioxidant, and release-related parameters in a series of polysaccharide/protein LbL films encapsulating anthocyanins. Dual controlled-release multilayers were produced by incorporating zein-anthocyanin coacervate complexes into spray-assisted LbL architectures composed of alginate, pectin, zein, and chitosan. Among the evaluated systems, pectin-chitosan films containing zein-anthocyanin (P/Ch/A) exhibited the highest encapsulation efficiency (77%), limited swelling over a wide pH range, and superior stiffness and tensile strength, together with high extensibility, compared to zein-containing films. The multivariate analysis was consistent with the direct experimental results and highlighted formulation-dependent clustering, with P/Ch/A showing the most balanced overall property profile for polyphenol delivery.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152335"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831804","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
P H K Nishimoto, G S Machado, M M C Meira, O Berenguel, R F Gouveia, D S T Martinez, E R Leite, B D Mattos, M V Lorevice
{"title":"Tailoring lignocellulosic nanofibrils via controlled delignification for high reinforcing capacity in poly (butylene adipate-co-terephthalate)-based nanocomposite films.","authors":"P H K Nishimoto, G S Machado, M M C Meira, O Berenguel, R F Gouveia, D S T Martinez, E R Leite, B D Mattos, M V Lorevice","doi":"10.1016/j.ijbiomac.2026.152392","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152392","url":null,"abstract":"<p><p>Motivated by the pursuit of minimal processing routes to obtain highly fibrillated nanocellulose for reinforcing biodegradable polymers, in this work we engineered lignin-containing cellulose nanofibrils (LCNFs) for optimal interfacial compatibility with poly(butylene adipate-co-terephthalate) (PBAT) on the preparation of nanocomposites films via casting. Lignin contents (from 3 to 15 wt%) were adjusted within nanofibrils from sugarcane bagasse via alkaline treatment and mechanical fibrillation produced LCNFs with diameter ranging from 4 to 5 nm. The residual lignin at nanofibers functioned as a toolbox to tailor its surface energy and assess their effects on mechanical performance and active properties of the nanocomposites, such as enhanced hydrophobicity and UV-shielding capability. Transmission Electron Microscopy images showed that residual lignin dictates the distribution of the LCNF within PBAT, modulating stress dissipation in the material. Spectroscopic analysis (Attenuated Total Reflectance-Fourier Transform Infrared and X-ray Photoelectron Spectroscopies) indicated that the aromatic moieties from lignin on the surface of the nanofibrils promoted supramolecular interactions with PBAT chains, improving the mechanical performance of the latter. The nanocomposite containing only 3 wt% LCNF with 11 wt% of lignin reached a 68% increase in elastic modulus compared to neat PBAT, outperforming commonly reported CNF-PBAT systems. Here, we highlight the great capabilities of minimally processed cellulose nanofibrils as a high-performance reinforcer in polymeric nanocomposites. Our residual lignin-centered compatibilization strategy utilizes the inherent synergy among biomass components for higher performance of nanocomposite.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152392"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831905","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
Junliang Dong, Yang Zhang, Xiaolu Jiao, Yuxin Pei, Zhichao Pei, Wenbin Zhang, Wenjing Sun
{"title":"Hyaluronic acid-targeted copper/manganese nanobioreactor with H<sub>2</sub>O<sub>2</sub> self-supply for simultaneous induction of ferroptosis and apoptosis in hepatocellular carcinoma.","authors":"Junliang Dong, Yang Zhang, Xiaolu Jiao, Yuxin Pei, Zhichao Pei, Wenbin Zhang, Wenjing Sun","doi":"10.1016/j.ijbiomac.2026.152393","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152393","url":null,"abstract":"<p><p>While doxorubicin (DOX)-based chemotherapy have revolutionized cancer treatment, their clinical potential is limited by off-target toxicity and low delivery efficiency. Reactive oxygen species (ROS)-based dynamic therapy has emerged as a cutting-edge modality for tumor-specific treatment. Herein, we introduce a tumor-microenvironment-activited Cu/Mn-based nanoreactor (CuO<sub>2</sub>@PMDH) that integrates targeted DOX delivery with chemodynamic therapy (CDT). The nanoreactor features CuO<sub>2</sub> encapsulated in a hyaluronan-modified Mn-based complex as the dominant component, enabling sequential activation by elevated glutathione (GSH) and H<sub>2</sub>O<sub>2</sub> in the tumor microenvironment. Within tumor cells, degradation of the nanoreactor co-releases DOX and CuO<sub>2</sub>, and subsequent acid-triggered hydrolysis of CuO<sub>2</sub> provides more H<sub>2</sub>O<sub>2</sub> locally that fuels a Cu/Mn-mediated Fenton-like reaction, generating highly toxic hydroxyl radicals (·OH). This amplified oxidative stress significantly triggers ferroptosis-an iron-independent form of regulated cell death driven by lipid peroxidation-thereby achieving a potent synergistic antitumor effect. In murine models, Cu/Mn nanoreactors showed potent antitumor efficacy through DOX-targeted delivery and efficient oxidative damage to tumor tissues. This spatiotemporally controlled dual-release strategy minimizes systemic toxicity while synergizing CT and CDT, offering a promising strategy for targeted cancer therapy.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152393"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831779","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}
{"title":"Exploration into the structural characteristics and functional properties of exopolysaccharide synthesized by Pseudoduganella armeniaca ZMN-3.","authors":"Xin Hu, Shuangshuang Dai, Chengci Liu, Chenhuiwan Zhang, Zhiyang Zhao, Lu Qiao, Jinhua Xu, Hongyu Jin, Xiaodong Xu, Zhen Yang, Jincheng Li, Lei Huang, Yingchun Mu, Haidong Huang","doi":"10.1016/j.ijbiomac.2026.152375","DOIUrl":"https://doi.org/10.1016/j.ijbiomac.2026.152375","url":null,"abstract":"<p><p>Microbial exopolysaccharides have attracted considerable interest for their diverse applications in biomedical industry, food processing, and environmental remediation. However, exopolysaccharides with high molecular weight and strong gel properties are relatively rare. In this study, an exopolysaccharide with high molecular weight was isolated from the fermentation broth of Pseudoduganella armeniaca ZMN-3 and purified using DEAE-52 ion-exchange and Sephadex G-75 chromatography. The yield of crude exopolysaccharide reached 2.72 ± 0.32 g/L. DSPS-2 consisted mainly of 45.6% glucose, 24.7% rhamnose, 17.6% galactose, 10.6% glucosamine, and a small amount of guluronic acid, with an average molecular weight of 3.65 × 10<sup>5</sup> Da. Structural analysis, such as GC-MS, SEM, TEM, and AFM revealed multiple glycosidic linkages forming a heteropolysaccharide with a fibrous and porous morphology. In terms of the functional properties, the results of FTIR and XPS confirmed the presence of hydroxyl, amino, and carboxyl groups in DSPS-2. DSPS-2 exhibited greater thermal stability with a degradation temperature about 275 °C. Rheological measurements confirmed pseudoplastic shear-thinning behavior of DSPS-2, and it exhibited strong gelation in the presence of Cr<sup>3+</sup>. These results demonstrated that DSPS-2 possessed favorable structural stability, viscosity, and metal-responsive gelation, highlighting its coordination with metal cations and providing a theoretical foundation for its potential application in environmental remediation.</p>","PeriodicalId":333,"journal":{"name":"International Journal of Biological Macromolecules","volume":" ","pages":"152375"},"PeriodicalIF":8.5,"publicationDate":"2026-05-05","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"147831763","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":1,"RegionCategory":"化学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}