Peptides最新文献

{"title":"Protective effects of PACAP against high glucose-induced inflammation on air-liquid interface corneal epithelium barrier","authors":"Grazia Maugeri ,&nbsp;Agata Grazia D’Amico ,&nbsp;Nicoletta Palmeri ,&nbsp;Elisabetta Pricoco ,&nbsp;Desiree Brancato ,&nbsp;Concetta Federico ,&nbsp;Velia D’Agata","doi":"10.1016/j.peptides.2025.171432","DOIUrl":"10.1016/j.peptides.2025.171432","url":null,"abstract":"<div><div>Diabetes mellitus (DM) is a chronic metabolic disease considered the “epidemic” of the new millennium, with devastating impacts on quality of life and global prevalence. One of the most common ocular complications is diabetic keratopathy (DK), often overlooked compared to other diabetes-related diseases. This disease causes significant corneal damage and is characterized by an overactive inflammatory condition, alteration of the corneal epithelial barrier, and delayed wound healing. Current therapies do not always ensure effective restoration of corneal function. In our previous study, we found that changes in the endogenous pituitary adenylate cyclase-activating polypeptide (PACAP) expression can concur for delayed epithelial wound healing in diabetic cornea. Moreover, the peptide showed cytoprotective effects on the corneal epithelium, promoting cell viability and wound healing under high glucose conditions, suggesting its potential effect in this diabetes-related disease. Therefore, this study aims to investigate the effect of PACAP against hyperglycemia-induced inflammation. To better resemble the natural conditions of corneal epithelium in vivo, an air-liquid interface (ALI) culture of the corneal epithelial cells was performed. The ALI corneal epithelium was cultured under high-glucose conditions to generate a model of DK. Our model reproduced well-established molecular and cellular characteristics of this pathology, including barrier thickness decrease and inflammation, with increased expression of IL-1β, TNF-α, and p-NF-kB. Our results indicated that PACAP significantly reduced the levels of proinflammatory cytokines IL-1β and TNF-α and inhibited the activation of NF-kB, an important mediator of inflammation. Moreover, PACAP improved epithelial morphology and corneal barrier thickness, suggesting its therapeutic potential in the treatment of DK.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"192 ","pages":"Article 171432"},"PeriodicalIF":2.8,"publicationDate":"2025-07-16","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144656020","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Substitution of a proline residue in the frog skin host-defense peptide, figainin-2PL by D-lysine generates an analog with potent activity against antibiotic-resistant ESKAPE pathogens","authors":"Laure Guilhaudis ,&nbsp;Taylor S. Cunning ,&nbsp;Jack J. Delaney ,&nbsp;Nigel G. Ternan ,&nbsp;Milena Mechkarska ,&nbsp;Samir Attoub ,&nbsp;J. Michael Conlon","doi":"10.1016/j.peptides.2025.171430","DOIUrl":"10.1016/j.peptides.2025.171430","url":null,"abstract":"<div><div>Figainin-2PL (FLGTVLKLGKAIAKTVVPMLTNAMQPKQ.NH₂) is active against a range of antibiotic-resistant bacteria as well as human tumor-derived cells. The study aimed to determine the effects of a proline-substitution on the biological potency of the peptide. Secondary structure predictions indicate that figainin-2PL can adopt a helix-turn-helix conformation in membrane-mimetic environments. Circular dichroism spectra are consistent with these predictions. Replacement of the Pro¹⁸ residue by either L-Ala, L-Lys or D-Lys increased the extent and stability of the helical domains. All substitutions increased cytotoxic activity against a range of human tumor-derived cells (between 1.5- and 3-fold) but major (between 4- and 10-fold) increases in hemolytic activity against mouse erythrocytes were also observed. While the substitutions Pro¹⁸ → L-Ala and Pro¹⁸ → L-Ala produced only minor and inconsistent changes in antibacterial activity, the [P18k] analog displayed a 2- to 4-fold greater (MIC and MBC in the range 1–8 µM) against the ESKAPE pathogens <em>Enterococcus faecalis</em>, <em>Enterococcus faecium, Klebsiella pneumoniae</em> and <em>Pseudomonas aeruginosa</em> compared with figainin-2PL and the peptide retained high potency against <em>Acinetobacter baumannii</em>, <em>Escherichia coli, Staphylococcus aureus</em> and <em>Clostridium difficile</em> (MIC and MBC = 2 µM). Consequently, the [P18k] peptide shows therapeutic potential for development into a broad-spectrum, topical antimicrobial agent.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"192 ","pages":"Article 171430"},"PeriodicalIF":2.8,"publicationDate":"2025-07-12","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144637713","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Phoenixin-14 ameliorates acetic acid-induced ulcerative colitis in rats via antioxidant, anti-inflammatory and anti-apoptotic mechanisms","authors":"Hülya Buzcu ,&nbsp;Meral Yüksel ,&nbsp;Seda Kırmızıkan ,&nbsp;Esra Çikler ,&nbsp;Berna Karakoyun","doi":"10.1016/j.peptides.2025.171431","DOIUrl":"10.1016/j.peptides.2025.171431","url":null,"abstract":"<div><div>Phoenixin (PNX), first discovered in the rat hypothalamus, was initially identified as a reproductive peptide. PNX-14 (14 amino acid isoform) has also been shown to function in cardiovascular regulation, neuroprotection, glucose metabolism, appetite, anxiety, and memory. We aimed to investigate the potential therapeutic role of PNX-14 in acetic acid (AA)-induced ulcerative colitis. Rats were given intrarectally 1 ml saline (control) or 5 % AA (colitis groups). The control group was treated intraperitoneally with saline, while the colitis groups were treated intraperitoneally with saline or PNX-14 (50 μg/kg/d) or gonadotrophin-releasing hormone (GnRH)-antagonist cetrorelix (CTX; 100 µg/kg/d) or CTX and PNX-14 or sulfasalazine as a positive control (100 mg/kg/d) instantly and once a day for 3 days following colitis induction. Colonic samples were evaluated histologically and biochemically [malondialdehyde (MDA), glutathione (GSH), myeloperoxidase (MPO), chemiluminescence (CL), pro-inflammatory cytokines (tumor necrosis factor-α, interferon-γ, interleukin (IL)-1β, IL-6, IL-8), caspase-3, and 8-hydroxy-2’-deoxyguanosine (8-OHdG) measurements] on the 3rd day. Elevated damage scores (macroscopic and microscopic), MPO, MDA, caspase-3, cytokines, and CL values, and decreased GSH levels of the colitis group were reversed by PNX-14 treatment (p &lt; 0.05–0.001). CTX or CTX plus PNX-14 reduced damage scores, caspase-3, 8-OHdG, cytokines, and CL values (p &lt; 0.05–0.001). Sulfasalazine treatment improved all parameters except MDA and GSH. PNX-14, which alleviates macroscopic, histological and biochemical parameters, can be considered as a potential therapeutic agent in ulcerative colitis with its anti-inflammatory, antioxidant and anti-apoptotic actions. Furthermore, despite its effects as an GnRH-antagonist, CTX has also revealed a similar beneficial role as PNX-14 in this ulcerative colitis model.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"192 ","pages":"Article 171431"},"PeriodicalIF":2.8,"publicationDate":"2025-07-12","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144634082","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Maximizing cost savings in heart failure management: The economic value of natriuretic peptide testing","authors":"Damien Gruson ,&nbsp;Gaetano Caforio ,&nbsp;Daniel D’Angela","doi":"10.1016/j.peptides.2025.171428","DOIUrl":"10.1016/j.peptides.2025.171428","url":null,"abstract":"<div><div>Heart failure (HF) remains a significant global health challenge, requiring cost-effective strategies to optimize patient outcomes and resource allocation. Natriuretic peptide (NP) testing has demonstrated substantial clinical and economic value in HF diagnosis, risk stratification, and management. This article examines the international evidence supporting NP testing, highlighting its role in reducing hospitalizations, optimizing medication use, and lowering healthcare expenditures. Addressing disparities in access and reimbursement policies can further enhance its adoption and impact across healthcare systems.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"192 ","pages":"Article 171428"},"PeriodicalIF":2.8,"publicationDate":"2025-07-11","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144626812","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Effect of central UAG on metabolic associated fatty liver disease: A possible mechanism involving in GLP-1 neural pathway","authors":"Wenxiu Xu ,&nbsp;Zixin Du ,&nbsp;Jing Wang ,&nbsp;Yating Gong ,&nbsp;Jiantong Yu ,&nbsp;Xueyuying Wang ,&nbsp;Xiangrong Sun ,&nbsp;Yanling Gong","doi":"10.1016/j.peptides.2025.171427","DOIUrl":"10.1016/j.peptides.2025.171427","url":null,"abstract":"<div><h3>Objective</h3><div>The study aimed to investigate the possible effect of central unacylated ghrelin (UAG) on metabolic associated fatty liver disease (MAFLD) and its underlying mechanism.</div></div><div><h3>Methods</h3><div>A high fat diet (HFD) was fed to rat to construct MAFLD model. UAG was administered via intra-cerebroventricular injection (ICV) and its effect on MAFLD was observed. Glucagon-like peptide-1 (GLP-1) neural pathway was observed via FluoroGold (FG) retrograde tracking combined with immunofluorescence. To assess the involvement of the GLP-1 pathway, GLP-1 receptor (GLP-1R) inhibitor Exendin (9−39) was injected prior to ICV of UAG.</div></div><div><h3>Results</h3><div>ICV administration of UAG significantly reduced lipid accumulation in liver and liver injury in MAFLD rats which was partially attenuated by Exendin(9−39). Central UAG upregulated and activated GLP-1 neurons in nucleus tractus solitarii (NTS), and increased GLP-1 projections from NTS to paraventricular hypothalamic nucleus (PVN) and ventral tegmental area (VTA), respectively. Consequently, GLP-1R in PVN and VTA was activated, resulting in decreased food intake and reward behavior, as well as increased hepatic insulin sensitivity via activation of IRS-1/PI3K/Akt signaling pathway. These changes downregulated key lipogenic enzymes, including fatty acid synthase (FAS), acetyl-CoA Carboxylase (ACC) and stearoyl-CoAdesaturase-1 (SCD-1), thereby alleviating MAFLD.</div></div><div><h3>Conclusion</h3><div>These findings suggest that central UAG might alleviate MAFLD by modulating GLP-1 neuronal pathway from NTS to PVN and VTA. Further studies are needed to identify the specific receptor for UAG and its potential interaction with GLP-1 or GLP-1R, which could provide direct evidence for the role of central UAG in regulating food intake and lipid metabolism in MAFLD.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171427"},"PeriodicalIF":2.8,"publicationDate":"2025-07-03","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144567720","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Characterization of thyrotropin-releasing hormone (TRH) and its receptors (TRHRs) in Nile tilapia: Molecular identification, ligand-receptor interaction and expression profile","authors":"Guixian Bu ,&nbsp;Tao Yong ,&nbsp;Yuqing Tang ,&nbsp;Jingyan Luo ,&nbsp;Yu Ji ,&nbsp;Li Guo ,&nbsp;Shasha Guo ,&nbsp;Shuai Yang ,&nbsp;Linyan Huang ,&nbsp;Xianyin Zeng ,&nbsp;Caiyun Sun ,&nbsp;Fengyan Meng","doi":"10.1016/j.peptides.2025.171426","DOIUrl":"10.1016/j.peptides.2025.171426","url":null,"abstract":"<div><div>Thyrotropin-releasing hormone (TRH) is a highly conserved tripeptide across vertebrates and regulates various biological processes, including energy metabolism, appetite, and reproduction. The functions of TRH are mediated by TRH receptors (TRHRs). In vertebrates, three <em>TRHR</em> subtypes have been identified, namely <em>TRHR1</em>, <em>TRHR2</em>, and <em>TRHR3</em>. However, <em>TRHR2</em> and <em>TRHR3</em> are often lost in some vertebrate lineages, highlighting the evolutionary divergence of the TRH-TRHR system. Although extensive research has been conducted in mammals, studies concerning the biological roles of TRH-TRHR system remain limited in fish. Therefore, using Nile tilapia (ti-) as a teleost model, we cloned the full-length cDNA of <em>TRH</em> and its receptors. Based on sequence alignment, synteny analysis and phylogenetic tree construction, we observed that <em>TRHR2</em> has been lost in Nile tilapia. The cloned <em>tiTRHRs</em> were designated as <em>tiTRHR1a</em>, <em>tiTRHR1b</em>, and <em>tiTRHR3</em>. Using luciferase reporter assays, signal pathway inhibitors and western blot analysis, we demonstrated that tiTRH could effectively activate tiTRHR1a, tiTRHR1b, and tiTRHR3, leading to the stimulation of intracellular calcium mobilization, MAPK/ERK, and cAMP/PKA signaling cascades. However, the efficiencies in activating signaling pathways differed between tiTRHR subtypes upon tiTRH treatment. Quantitative real-time PCR revealed that <em>tiTRH</em> and <em>tiTRHRs</em> were mainly expressed in the central nervous system (CNS) including the hypothalamus. Moreover, hypothalamic mRNA levels of <em>tiTRH</em> and <em>tiTRHR1b</em> were significantly downregulated in response to short-term fasting and acute cold exposure, while <em>tiTRHR1a</em> expression was only responsive to acute cold stress. Collectively, our data will facilitate a better understanding of the components and functions of the TRH-TRHR system in teleost.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171426"},"PeriodicalIF":2.8,"publicationDate":"2025-07-02","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144549721","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Recombinant production of isotope-labeled human α-defensin 5 via calmodulin fusion and insights into its expression enhancement","authors":"Shaonan Yan ,&nbsp;Hao Gu ,&nbsp;Mitsuki Shibagaki ,&nbsp;Jeremia Oktavian Chrisnanto ,&nbsp;Fumi Hirai ,&nbsp;Hiroyuki Kumeta ,&nbsp;Yasuhiro Kumaki ,&nbsp;Yuki Yokoi ,&nbsp;Kiminori Nakamura ,&nbsp;Takashi Kikukawa ,&nbsp;Tokiyoshi Ayabe ,&nbsp;Tatsuya Arai ,&nbsp;Tomoyasu Aizawa","doi":"10.1016/j.peptides.2025.171425","DOIUrl":"10.1016/j.peptides.2025.171425","url":null,"abstract":"<div><div>Human α-defensin 5 (HD5), a cysteine-rich antimicrobial peptide critical for intestinal innate immunity, has been extensively studied for its structural and functional properties. Both the reduced form (HD5red) and the oxidized form (HD5oxi) exist <em>in vivo</em> and exhibit distinct antimicrobial activity spectra. In this study, we developed an efficient method to overexpress recombinant HD5 in <em>Escherichia coli</em> (<em>E. coli</em>) BL21 (DE3) strain by using calmodulin (CaM), which also interacts with antimicrobial peptides, as a fusion partner. Fusion expression suppressed the degradation of HD5 and reduced its toxicity to host cells. Following purification of the fusion protein and enzymatic cleavage to release the HD5 region, we successfully obtained sufficient amounts (yielding 1.5–1.7 mg/L culture) of active recombinant HD5oxi and HD5red for various applications, including stable isotope-labeled peptides for NMR analysis. Furthermore, we investigated the protective effect of CaM fusion and the mechanism of disulfide bond formation using CD and NMR spectroscopy, structural prediction, and molecular dynamics simulations. Our results suggest that the appropriate interaction strength between CaM and the HD5 region in the fusion state is a key factor for stable production.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171425"},"PeriodicalIF":2.8,"publicationDate":"2025-06-27","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144529211","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Mechanical stretch improves high glucose-induced leptin resistance thus promoting glucose uptake of C2C12 myoblasts","authors":"Shaoting Fu ,&nbsp;Jin Peng ,&nbsp;Xiaohui Wang","doi":"10.1016/j.peptides.2025.171424","DOIUrl":"10.1016/j.peptides.2025.171424","url":null,"abstract":"<div><div>Exercise has been shown to alleviate central leptin resistance (LR), while the effects of exercise on peripheral especially skeletal muscle LR and its mechanisms remain poorly understood. In this study, we explored the effect and mechanisms of mechanical stretch (mimic exercise in vitro) on high glucose-induced LR of C2C12 myoblasts. We found (1) 65 mM glucose-induced LR of C2C12 cells was improved by 15 % stretch lasting for 3 or 6 h (represented as decrease of leptin and increases of leptin receptor (LepR) and glucose uptake), with more glucose uptake in 6h-stretch than 3h-stretch; (2) 15 % stretch changed the levels of important regulators of LR, including increasing signal transducer and activator of transcription 3 (STAT3), decreasing protein tyrosine phosphatase 1B (PTP1B) and suppressor of cytokine signaling-3 (SOCS3), with higher alterations of STAT3 and SOCS3 in 6h-stretch than 3h-stretch; (3) 15 % stretch activated the classical pathway regulating glucose metabolism, including increasing the levels of insulin-like growth factor (IGF-1), IGF-1 receptor (IGF-1R), insulin receptor substrate 1 (IRS-1), protein kinase B (Akt) and glucose transporter 4 (GLUT4), enhancing activities of phosphoinositide 3-kinase (PI3K) and Akt, with more increases of IGF-1R and IRS1 in 6h-stretch than 3h-stretch and enhanced GLUT4 only in 6h-stretch. Altogether, 15 % stretch alleviated high glucose-induced LR of C2C12 myoblasts through increasing STAT3 and decreasing PTP1B and SOCS3, then enhancing glucose uptake via IGF-1/IGF-1R-PI3K/Akt-GLUT4 pathway, which would deepen our understanding how exercise improved skeletal muscle LR and subsequent glucose uptake.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171424"},"PeriodicalIF":2.8,"publicationDate":"2025-06-27","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144522375","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Synthesis of the plant cyclotide cyO14 via the hydrazide strategy and investigation of its antibacterial and insecticidal activities","authors":"Fawei He ,&nbsp;Yunfei Cui ,&nbsp;Xue Tang ,&nbsp;Dongting Zhangsun ,&nbsp;Sulan Luo ,&nbsp;Yong Wu","doi":"10.1016/j.peptides.2025.171423","DOIUrl":"10.1016/j.peptides.2025.171423","url":null,"abstract":"<div><div>The plant cyclotide <strong>cyO14</strong>, a member of the Möbius subfamily, was synthesized using an hydrazide-based strategy, and its antibacterial, insecticidal, and hemolytic activities were investigated. The linear precursor of cyO14 was prepared via solid-phase peptide synthesis (SPPS) on an hydrazide resin, followed by head-to-tail cyclization through an hydrazide-mediated ligation and disulfide bond formation via spontaneous oxidation. The synthesized cyclotide exhibited a structure identical to that of the naturally occurring counterpart. Biological evaluation demonstrated that <strong>cyO14</strong> possessed significant antibacterial activity against <em>Cryptococcus neoformans</em> and <em>Bacillus subtilis</em>, with a minimum inhibitory concentration (MIC) of 1 μM. Mechanistic studies revealed that <strong>cyO14</strong> exerted its antibacterial effects by disrupting bacterial membranes. Moreover, <strong>cyO14</strong> exhibited negligible hemolytic activity (HD₅₀ &gt; 1000 μM), suggesting excellent biocompatibility. In insecticidal assays, <strong>cyO14</strong> effectively inhibited the growth and development of <em>Helicoverpa armigera</em>. These findings indicate that the hydrazide-mediated cyclization strategy is an efficient method for the synthesis of Möbius subfamily cyclotides, and that <strong>cyO14</strong> possesses promising pharmaceutical and agricultural potential due to its potent antibacterial and insecticidal activities coupled with high biological safety.</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171423"},"PeriodicalIF":2.8,"publicationDate":"2025-06-19","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144340341","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}

{"title":"Endogenous opiates and behavior: 2024","authors":"Richard J. Bodnar","doi":"10.1016/j.peptides.2025.171422","DOIUrl":"10.1016/j.peptides.2025.171422","url":null,"abstract":"<div><div>This paper is the forty-seventh consecutive installment of the annual anthological review of research concerning the endogenous opioid system, summarizing articles published during 2024 that studied the behavioral effects of molecular, pharmacological and genetic manipulation of opioid peptides and receptors as well as effects of opioid/opiate agonists and antagonists. The review is subdivided into the following specific topics: molecular-biochemical effects and neurochemical localization studies of endogenous opioids and their receptors (1), the roles of these opioid peptides and receptors in pain and analgesia in animals (2) and humans (3), opioid-sensitive and opioid-insensitive effects of nonopioid analgesics (4), opioid peptide and receptor involvement in tolerance and dependence (5), stress and social status (6), learning and memory (7), eating and drinking (8), drug abuse and alcohol (9), sexual activity and hormones, pregnancy, development and endocrinology (10), mental illness and mood (11), seizures and neurologic disorders (12), electrical-related activity and neurophysiology (13), general activity and locomotion (14), gastrointestinal, renal and hepatic functions (15), cardiovascular responses (16), respiration and thermoregulation (17), and immunological responses (18).</div></div>","PeriodicalId":19765,"journal":{"name":"Peptides","volume":"191 ","pages":"Article 171422"},"PeriodicalIF":2.8,"publicationDate":"2025-06-16","publicationTypes":"Journal Article","fieldsOfStudy":null,"isOpenAccess":false,"openAccessPdf":"","citationCount":null,"resultStr":null,"platform":"Semanticscholar","paperid":"144314462","PeriodicalName":null,"FirstCategoryId":null,"ListUrlMain":null,"RegionNum":4,"RegionCategory":"医学","ArticlePicture":[],"TitleCN":null,"AbstractTextCN":null,"PMCID":"","EPubDate":null,"PubModel":null,"JCR":null,"JCRName":null,"Score":null,"Total":0}